PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CAMTA
Protein Properties Length: 1118aa    MW: 126195 Da    PI: 5.7212
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023491.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1177.12.3e-55201362118
         CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcy 99 
                  ++ ++rwl++ ei++iL n+++++++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+e+n++fqrr+y
  CCG023491.1  20 VEAQNRWLRPAEIVEILSNYQRFRIAPEPAHMPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEDNENFQRRSY 117
                  6679********************************************************************************************** PP

         CG-1 100 wlLeeelekivlvhylevk 118
                  w+Leeel++ivlvhy+evk
  CCG023491.1 118 WMLEEELSHIVLVHYREVK 136
                  ****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.37415141IPR005559CG-1 DNA-binding domain
SMARTSM010762.1E-7518136IPR005559CG-1 DNA-binding domain
PfamPF038591.2E-4821134IPR005559CG-1 DNA-binding domain
SuperFamilySSF812962.45E-15537623IPR014756Immunoglobulin E-set
PROSITE profilePS5029718.961708841IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.4E-17717833IPR020683Ankyrin repeat-containing domain
CDDcd002043.44E-13718829No hitNo description
SuperFamilySSF484031.55E-16724831IPR020683Ankyrin repeat-containing domain
PfamPF127967.9E-7742832IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.698770802IPR002110Ankyrin repeat
SMARTSM002480.011770799IPR002110Ankyrin repeat
SMARTSM00248930809838IPR002110Ankyrin repeat
SuperFamilySSF525401.14E-7940994IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000152943965IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.206946973IPR000048IQ motif, EF-hand binding site
PfamPF006120.0047946964IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0039966988IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.597967991IPR000048IQ motif, EF-hand binding site
PfamPF006122.3E-4969988IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1118 aa     Download sequence    Send to blast
MADSRRYPLG NQLDIQQILV EAQNRWLRPA EIVEILSNYQ RFRIAPEPAH MPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKSGSVDVLH CYYAHGEDNE NFQRRSYWML  120
EEELSHIVLV HYREVKGTRT NVNRIKEHEE PIPCSQETED MMLNSETDTS VSSSFRSNGY  180
QVSTRTTDST SMNSALASEY EDAESGYNNQ ASSRFHSFLE MQRPAMEKMD AGASIPYDHM  240
PFSSGYQGKM PAVPVMEFIS PAQVNTAKDT IGTEPASEPQ KDFDLPSWED VLENCSREIE  300
SVPFQTTFLS QADTVGLGVI PKQDDILEKF LTNSFDKRQG MEGVIPKQED ILEKIITNSF  360
DRSQDIGSHL LDQEAWQTIE GGYSHRPKWS LDQKLHLDAD LTARFHDQQL DSGNFINTFE  420
PFCAQENDNH IRKDLQIQPA NSDHGMTLEG KSIYSTSVKQ HILDDSRTEG LKKLDSFTRW  480
MSKELEDVDQ PHLQSSSGTY WITAESENVV DADNPSQGHL DTYTLGPSLS QDQLFSIIDF  540
SPNWAYAGTE IKVLVMGRFL KSREAAENFK WSVMFGEVEV PAEVLADGIL RCATPLHKAG  600
RVPFYVTCSN RVACSEVREF EYRLSHVQDI TYNYINVATE DLHMRLAKLL SLSSAFPSKY  660
DSSDVDEISQ LSNKISSLLK EGNETWDQML KLTSLEGFSS EKLKDQLLQK ALKEQLHEWL  720
LQKVAEGGKG PSVLDEGGQG VLHFAAALGY EWALEPTIVA GVSVNFRDVN GWTALHWAAY  780
YGRERTVASL IHLGAAPGAI TDPTPKYPTG RTPADLASAN GHKGISGFLA ESALSAHLSS  840
LNLEKQDGDA AESSGIPASL TVSDCNETPV KDADIPIGLS LKDSLAAVCN ATQAAARIHQ  900
VFRVQSFQKK QLKEYGDDKF GMSHERALSL IAVKSQKAGQ YDEPVHAAIR IQNKFRGWKG  960
RKEFLIIRQR IVKIQAHVRG HQVRKNYRKI IWSVGILDKI ILRWRRKGSG LRGFKSEALT  1020
EGSSMQVVSS KDDDDDFLKE GRKQTEERSQ IALARVKSMH QHPEAREQYH RLRNVVAEIQ  1080
ETKAMYEWAN NSEAMVEFDD LINLETLWDG DTFLPTDS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031016.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLU5G7F70.0U5G7F7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82842735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1